Recombinant <b>TEAD3</b> (R218-D435) YAP-binding domain, TEA domain transcription factor 3, Transcriptional enhancer factor TEF-5

Recombinant <b>TEAD3</b> (R218-D435) YAP-binding domain, TEA domain transcription factor 3, Transcriptional enhancer factor TEF-5

1 mg
€1.544,00 EUR
Skip to product information
Recombinant <b>TEAD3</b> (R218-D435) YAP-binding domain, TEA domain transcription factor 3, Transcriptional enhancer factor TEF-5

Recombinant TEAD3 (R218-D435) YAP-binding domain, TEA domain transcription factor 3, Transcriptional enhancer factor TEF-5

€1.544,00 EUR

Extra aliquot of protein storage buffer included.

Quantity

  • Purity > 95%
  • Monodisperse
  • Melting temperature of 63°C
Quality Plus Siegel

The TEA domain transcription factor 3 (TEAD3) protein is a transcription factor that interacts with the downstream effectors YAP and TAZ of the Hippo signaling pathway. Given the central role of Hippo signaling in regulating essential cellular processes, TEAD3 is also associated with a wide range of diseases, making its YAP-binding domain a particularly attractive target for therapeutic drug discovery. Our recombinant TEAD3(R218-D435) is of high quality and is well suited for researchers pursuing the development of therapeutics for targeted protein degradation and anti-cancer treatments targeting the YAP-binding domain.

Our recombinant S_TEAD3(R218-D435) protein contains the C-terminal YAP-binding domain of the human transcription factor TEAD3. It has an additional N-terminal Serine, which remains from the TEV cleavage site.

Protein Construct: TEAD3(R218-D435)
Source: Human
Expression Host: Escherichia coli
Molecular weight [kDa]: 25.1
pI: 6.7
Extinction Coefficient [M-1cm-1]: 21890
Concentration: 10 mg/mL
Storage Buffer: 20 mM Tris pH 7.5, 150 mM NaCl, 5% Glycerol, 2 mM DTT
Tag: none

Amino acid sequence:

SRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

QC Data: Datasheet
Purity SDS: >95 %
Hydrodynamic Radius (nm): 2.78
Polydispersity Index (PDI): 0.13
Tm (°C): 63.3
Ton (°C): 56.9

Structure and function

TEAD3 is part of the TEAD transcription factor family that regulates important cellular functions like tissue homeostasis, cell growth and proliferation. TEAD3 drives gene expression via its highly conserved TEA DNA-binding domain, which folds into a three-helix bundle. The H3 helix incorporates the DNA recognition surface which features 3 serines essential for DNA binding activities. In addition TEAD3 has a C-terminal interaction domain, which enables binding to transcriptional cofactor Yes-associated protein (YAP) and transcriptional coactivator with PDZ-binding motif (TAZ), which is obligatory for TEAD3 to regulate transcription. The C-terminal domain adopts an immunoglobulin-like ß-sandwich fold while the YAP itself is mostly unstructured and only forms secondary structure elements upon binding to TEAD3. Both TEA domain and C-terminal domain are connected via a proline-rich region, which is necessary for interaction of the C-terminal domain with YAP/TAZ.


TEAD3 as an important drug target

TEAD3 is a transcription factor that functions downstream of the oncogenic co-activators YAP and TAZ, key effectors of the Hippo signaling pathway. The interaction with YAP/TAZ, enables TEAD3 to bind DNA and regulates the expression of genes involved in proliferation, differentiation, and apoptosis. Hippo signaling controls gene expression largely through suppressing YAP and TAZ. In several types of cancer, however, dysregulation of Hippo signaling causes YAP/TAZ accumulation and tumor progression, making inhibition of the interaction of TEAD3 with YAP a promising therapeutic strategy.
One interaction inhibition strategy involves a hydrophobic pocket in the C-terminal region which is under physiological conditions occupied by a palmitate molecule binding to a conserved cysteine. This pocket has been shown to be important for TEAD3 stability as well as the TEAD3-YAP interaction, leading to the development of several small molecule inhibitors targeting this site. Another TEAD3 inhibition strategy is targeting the transcription factor with Proteolysis-targeting chimeras (PROTACs), which recruit the protein to an E3 ligase, thereby inducing its ubiquitination and degradation by the proteasome.
TEAD3 is not only an important target in cancer research but has also become the focus of reproductive biology due to its association with maternal-fetal immune tolerance. In addition, studies in neuroscience have provided initial evidence for the involvement of TEAD3 in neural development and have linked it to neurodegenerative diseases such as Alzheimer's disease.


References:
Hodáková Z, Landin-Malt, A., Benhaddou, A., Zider, A., Flagiello, D..(2016). An evolutionary, structural and functional overview of the mammalian TEAD1 and TEAD2 transcription factors. Gene. doi: 10.1016/j.gene.2016.07.028

Kang, C., Xu, W., Song, H., Hong, W..(2026). Illuminating Clinical TEAD Inhibitors Through Structural Biology.Journal of Medicinal Chemistry. doi: 10.1021/acs.jmedchem.6c01021

Gu, B., Ferreira, L.M.R., Herrera, S., Brown, L., Lieberman, J., Sherwood, R.I., Meissner, T.B., Strominger, J..L. (2025). The TEA domain transcription factors TEAD1 and TEAD3 and WNT signaling determine HLA-G expression in human extravillous trophoblasts.PNAS. doi: 10.1073/pnas.2425339122

Chen, D., Wigglesworth-Littlewood, S. & Gunn-Moore, F.J. (2025). The Hippo signaling pathway as a therapeutic target in Alzheimer’s disease.Mol Neurodegeneration. doi: 10.1186/s13024-025-00891-4
Zwei Proteinstrukturen unter einer Lupe

Looking for a specific protein target?

We are continuously expanding our recombinant protein portfolio. If your target is not yet listed in the shop, our team will be happy to discuss availability and next steps.