Recombinant <b>TRIM21</b>(V287-L465), PRYSPRY domain, Tripartite motif-containing 21 protein

Recombinant <b>TRIM21</b>(V287-L465), PRYSPRY domain, Tripartite motif-containing 21 protein

1 mg
€2.950,00 EUR
Skip to product information
Recombinant <b>TRIM21</b>(V287-L465), PRYSPRY domain, Tripartite motif-containing 21 protein

Recombinant TRIM21(V287-L465), PRYSPRY domain, Tripartite motif-containing 21 protein

€2.950,00 EUR

Extra aliquot of protein storage buffer included.

Quantity

  • Purity > 95%
Quality Plus Siegel

The human tripartite motif-containing 21 (TRIM21) protein is a ubiquitin E3 ligase that plays a critical role in the ubiquitin-proteasome pathway, specifically in the recognition of target proteins and their recruitment to the proteasome. The PRYSPRY domain of TRIM21 plays an important role in the recognition of antibody-coated pathogens and subsequent degradation by the proteasome, making it an important target in the development of bivalent molecules such as Proteolysis Targeting Chimeras (PROTACs). Our recombinant TRIM21(PRYSPRY) protein is of high quality and is well suited for researchers pursuing the development of novel PROTAC strategies.

Our recombinant GSG_TRIM21(V287-L465) protein contains the C-terminal PRY-SPRY domain of TRIM21, which spans residues V287 - L465. The construct also contains an N-terminal GSG linker, which serves to optimize tag cleavage by a TEV Protease.

Protein Construct: GSG_TRIM21(V287-L465)
Source: Human
Expression Host: Escherichia coli
Molecular weight [kDa]: 20.5
pI: 5.9
Extinction Coefficient [M-1cm-1]: 43430
Tag: none

Amino acid sequence:

GSGVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPL

Structure and function

The tripartite motif (TRIM) protein family includes around 70 proteins involved in a wide range of cellular functions such as cell growth, differentiation, and programmed cell death. The multidomain TRIM21 protein consists of an N-terminal RING finger domain with E3 ligase activity, a coiled-coil domain mediating oligomerization after ubiquitination of substrates targeted for degradation as well as a C-terminal PRYSPRY domain. The latter adopts a distorted beta-sandwich fold and features a canonical binding interface for the Fc region of immunoglobulins which coat pathogens that can be marked for proteasomal degradation.


TRIM21 as an important drug target

A key element of TRIM21’s activity is the PRYSPRY domain, as it enables binding to the Fc regions of immunoglobulins and thus the recognition of antibody-bound pathogens. The PRYSPRY domain remains a central target for therapeutic intervention, as it contains, in addition to two antibody-binding pockets, other smaller ligand binding pockets (Kim et al., 2025). The capacity of the TRIM21-PRYSPRY domain to recognize pathogenic cargo bound to endogenous antibodies has been utilized in the so-called TRIM-AWAY technique. In this approach, introducing an antibody that targets a specific protein into cells triggers its degradation through full-length TRIM21.
The development of bivalent molecules has also been successful in the field of anticancer therapeutics, where so-called “TRIMTACs”, direct TRIM21 E3 ligase to nuclear pore proteins, disrupting nuclear transport and leading to rapid cancer cell death (Scemama de Gialluly et al., 2025). It has also been discovered that full-length TRIM21 preferentially ubiquitinates large, multimeric complexes in vivo, which makes it a potentially interesting E3 ligase for the development of PROTACs against protein aggregates.
Additionally, mutations in the PRYSPRY domain have been linked to autoimmune diseases like rheumatoid arthritis or systemic lupus erythematosus, making it an important target for autoimmune therapeutics.


References:
Kim, Da Som, Park, Youngjae, Tsokos, George C., CHo, Mi-La, Kwok, Seung-Ki. (2025). The Ubiquitin E3 ligase TRIM21 suppresses type I interferon signaling via STING degradation and ameliorates systemic autoimmunity.Nature. doi: 10.1038/s12276-025-01490-5

Scemama de Gialluly, M.A., Allen, A.R., Hayes, E.H. et al. (2025). Elaboration of molecular glues that target TRIM21 into TRIMTACs that degrade protein aggregates.Nature Communications. doi: 10.1038/s41467-025-61818-7

Kim, Y., Lučić, A., Lenz, C. et al. (2025). Crystallographic fragment screening reveals ligand hotspots in TRIM21 PRY-SPRY domain.Communications Chemistry. doi: 10.1038/s42004-025-01574-3

James, Leo C., Keeble, Anthony H., Khan, Zahra, Trowsdale, John. (2007). Structural basis for PRYSPRY-mediated tripartite motif (TRIM) protein function. Mol Neurodegeneration. doi: 10.1073/pnas.0609174104
Zwei Proteinstrukturen unter einer Lupe

Looking for a specific protein target?

We are continuously expanding our recombinant protein portfolio. If your target is not yet listed in the shop, our team will be happy to discuss availability and next steps.